90
|
GenScript corporation
biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide Biotinylated Human (Ggqdvt{Py}Aqlhsltrlreate) Or Murine (Ggqdvt{Py}Aqlcsrtlrqgaaas) Pirb Derived Phosphopeptide, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide/product/GenScript corporation Average 90 stars, based on 1 article reviews
biotinylated human (ggqdvt{py}aqlhsltrlreate) or murine (ggqdvt{py}aqlcsrtlrqgaaas) pirb derived phosphopeptide - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
CEM Corporation
biotinylated ba derivatives Biotinylated Ba Derivatives, supplied by CEM Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated ba derivatives/product/CEM Corporation Average 90 stars, based on 1 article reviews
biotinylated ba derivatives - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
CPC Scientific
biotinylated peptide derived human bim (residues 51-76 Biotinylated Peptide Derived Human Bim (Residues 51 76, supplied by CPC Scientific, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated peptide derived human bim (residues 51-76/product/CPC Scientific Average 90 stars, based on 1 article reviews
biotinylated peptide derived human bim (residues 51-76 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
PiChem GmbH
biotinylated baffr derived peptide (minibr3) Biotinylated Baffr Derived Peptide (Minibr3), supplied by PiChem GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated baffr derived peptide (minibr3)/product/PiChem GmbH Average 90 stars, based on 1 article reviews
biotinylated baffr derived peptide (minibr3) - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
Rapp Polymere GmbH
biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs Biotinylated Peg Derivative With A Terminal Biotin Biotin Conh Peg O C 3 H 6 Conhs, supplied by Rapp Polymere GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs/product/Rapp Polymere GmbH Average 90 stars, based on 1 article reviews
biotinylated peg derivative with a terminal biotin biotin-conh-peg-o-c 3 h 6 -conhs - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
Cayman Chemical
biotinylated derivatives Biotinylated Derivatives, supplied by Cayman Chemical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated derivatives/product/Cayman Chemical Average 90 stars, based on 1 article reviews
biotinylated derivatives - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin Biotinylated Napi2b Derived Peptide Qinvtvpstanctspslcwtdgiqnwtmkn Biotin, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin/product/GenScript corporation Average 90 stars, based on 1 article reviews
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
Biomedal Inc
peptides (native and deamidated) and terminal modifications (i.e. biotinylated peptides) derived from gliadin 8-mer sequence Peptides (Native And Deamidated) And Terminal Modifications (I.E. Biotinylated Peptides) Derived From Gliadin 8 Mer Sequence, supplied by Biomedal Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/peptides (native and deamidated) and terminal modifications (i.e. biotinylated peptides) derived from gliadin 8-mer sequence/product/Biomedal Inc Average 90 stars, based on 1 article reviews
peptides (native and deamidated) and terminal modifications (i.e. biotinylated peptides) derived from gliadin 8-mer sequence - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
biomers.net gmbh
5′-biotinylated derivatives 5′ Biotinylated Derivatives, supplied by biomers.net gmbh, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/5′-biotinylated derivatives/product/biomers.net gmbh Average 90 stars, based on 1 article reviews
5′-biotinylated derivatives - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
Genemed Synthesis
n-terminally biotinylated t20 derivative (residues 635 to 673) N Terminally Biotinylated T20 Derivative (Residues 635 To 673), supplied by Genemed Synthesis, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/n-terminally biotinylated t20 derivative (residues 635 to 673)/product/Genemed Synthesis Average 90 stars, based on 1 article reviews
n-terminally biotinylated t20 derivative (residues 635 to 673) - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
Cayman Chemical
cyclopentenone prostaglandins including biotinylated derivatives Cyclopentenone Prostaglandins Including Biotinylated Derivatives, supplied by Cayman Chemical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/cyclopentenone prostaglandins including biotinylated derivatives/product/Cayman Chemical Average 90 stars, based on 1 article reviews
cyclopentenone prostaglandins including biotinylated derivatives - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
90
|
Nanocs Inc
biotinylated derivative Biotinylated Derivative, supplied by Nanocs Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated derivative/product/Nanocs Inc Average 90 stars, based on 1 article reviews
biotinylated derivative - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |